PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco016137.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family SRS
Protein Properties Length: 157aa    MW: 16855.4 Da    PI: 9.4234
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco016137.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF70286.65.7e-27109156552
       DUF702   5 tasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrer 52 
                  +++ qdCGnq kkdC+ +RCRtCCksrgfdC+thvks Wvpaa+rrer
  Aco016137.1 109 SSTYQDCGNQVKKDCTNRRCRTCCKSRGFDCSTHVKSMWVPAARRRER 156
                  5678*******************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051424.1E-23110156IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.1E-24113153IPR006510Zinc finger, lateral root primordium type 1
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MSGAETPPET PEWVSTVAYF MVGTQASEAL AGKTTPLSSH SPFIMVPLEI NMLLPGAAAS  60
GIQFWQPQPQ LPSRPVAAIF YMRKPVPMFN SPGILSGAGV GLAGLSSSSS TYQDCGNQVK  120
KDCTNRRCRT CCKSRGFDCS THVKSMWVPA ARRRER*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703065e-37HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015622050.13e-32PREDICTED: protein LATERAL ROOT PRIMORDIUM 1
TrEMBLA0A0E0CD352e-33A0A0E0CD35_9ORYZ; Uncharacterized protein
STRINGLOC_Os01g72490.11e-31(Oryza sativa Japonica Group)
STRINGBGIOSGA000090-PA6e-31(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35793679
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.34e-24Lateral root primordium (LRP) protein-related